Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens COX19, cytochrome c oxidase assembly factor (COX19) (NM_001031617). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q49B96 |
| Entry Name | COX19_HUMAN |
| Gene Names | COX19 |
| Alternative Gene Names | |
| Alternative Protein Names | Cytochrome c oxidase assembly protein COX19 (hCOX19) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 90 |
| Molecular Weight(Da) | 10394 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQEPLEKLGFGDLTSGKSEAKK |
Background
| Function | FUNCTION: Required for the transduction of an SCO1-dependent redox signal from the mitochondrion to ATP7A to regulate cellular copper homeostasis (PubMed:23345593). May be required for the assembly of mitochondrial cytochrome c oxidase (By similarity). {ECO:0000250|UniProtKB:Q3E731, ECO:0000269|PubMed:23345593}. |
| Pathway | |
| Protein Families | COX19 family |
| Tissue Specificity | Ubiquitously expressed. Highly expressed in skeletal muscle. {ECO:0000269|PubMed:16212937}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |