Recombinant Human COUP transcription factor 1(NR2F1)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Protein Tag N-terminal 6xHis-tagged
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Level Not test.
Biological Activity
Uniprot ID P10589
Gene Names NR2F1
Alternative Names (COUP-TF1)(COUP transcription factor I)(COUP-TF I)(Nuclear receptor subfamily 2 group F member 1)(V-erbA-related protein 3)(EAR-3)
Expression Region 1-423aa
Product Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.54 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-146℃.
Protein Length Full Length
Molecular Weight 50.2 kDa
Protein Sequence MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQCS
Background
Research Areas Epigenetics and Nuclear Signaling
Relevance Coup (chicken ovalbumin upstream promoter) transcription factor binds to the ovalbumin promoter and, in conjunction with another protein (S300-II) stimulates initiation of transcription. Binds to both direct repeats and palindromes of the 5'-AGGTCA-3' motif. Represses transcriptional activity of LHCG.
Function
Reference "EAR2 and EAR3/COUP-TFI regulate transcription of the rat LH receptor." Zhang Y., Dufau M.L. Mol. Endocrinol. 15:1891-1905(2001)
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$298.00
In stock
SKU
EB-N231067

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human COUP transcription factor 1(NR2F1)
Copyright © 2021-present Echo Biosystems. All rights reserved.