Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P80365 |
| Gene Names | HSD11B2 |
| Alternative Names | 11-beta-hydroxysteroid dehydrogenase type 2 ;11-DH2 ;11-beta-HSD211-beta-hydroxysteroid dehydrogenase type II ;-HSD11 type IINAD-dependent 11-beta-hydroxysteroid dehydrogenase ;11-beta-HSDShort chain dehydrogenase/reductase family 9C member 3 |
| Expression Region | Full Length(1-405aa ) |
| Molecular Weight | 46.1 kDa |
| Protein Sequence | MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids. |
| Involvement in Disease | Apparent mineralocorticoid excess (AME) |
| Subcellular Location | Microsome, Endoplasmic reticulum |
| Protein Families | Short-chain dehydrogenases/reductases (SDR) family |
| Tissue Specificity | HSD11B2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |