Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P28845 |
| Gene Names | HSD11B1 |
| Alternative Names | 11-beta-hydroxysteroid dehydrogenase 1 ;11-DH ;11-beta-HSD1Short chain dehydrogenase/reductase family 26C member 1 |
| Expression Region | Partial(25-292aa ) |
| Molecular Weight | 45.5 kDa |
| Protein Sequence | EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol . |
| Involvement in Disease | Cortisone reductase deficiency 2 (CORTRD2) |
| Subcellular Location | Endoplasmic reticulum membrane, Single-pass type II membrane protein |
| Protein Families | Short-chain dehydrogenases/reductases (SDR) family |
| Tissue Specificity | HSD11B1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |