Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 1(HSD11B1),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P28845
Gene Names HSD11B1
Alternative Names 11-beta-hydroxysteroid dehydrogenase 1 ;11-DH ;11-beta-HSD1Short chain dehydrogenase/reductase family 26C member 1
Expression Region Partial(25-292aa )
Molecular Weight 45.5 kDa
Protein Sequence EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol .
Involvement in Disease Cortisone reductase deficiency 2 (CORTRD2)
Subcellular Location Endoplasmic reticulum membrane, Single-pass type II membrane protein
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity HSD11B1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE3HU10888

Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 1(HSD11B1),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 1(HSD11B1),partial
Copyright © 2026-present Echo Bio. All rights reserved.