Recombinant Human Complement factor H-related protein 1(CFHR1),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Protein Tag N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Purity Greater than 85% as determined by SDS-PAGE.
Endotoxin Level Not test.
Biological Activity
Uniprot ID Q03591
Gene Names CFHR1
Alternative Names (FHR-1)(H factor-like protein 1)(H-factor-like 1)(H36)
Expression Region 132-221aa
Product Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.126 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-218℃.
Protein Length Partial
Molecular Weight 45.2 kDa
Protein Sequence RGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYPSGERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITS
Background
Research Areas Cardiovascular
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$250.00
In stock
SKU
EB-N231139

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Complement factor H-related protein 1(CFHR1),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.