Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P01031 |
| Gene Names | C5 |
| Alternative Names | C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4 |
| Expression Region | Partial(678-751aa ) |
| Molecular Weight | 24.3 kDa |
| Protein Sequence | TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Activation of C5 by a C5 convertase initiates the spontaneous assbly of the late complent components, C5-C9, into the mbrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assbled.Derived from proteolytic degradation of complent C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes . C5a is also a potent chokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation. |
| Involvement in Disease | Complement component 5 deficiency (C5D) |
| Subcellular Location | Secreted |
| Protein Families | |
| Tissue Specificity | C5 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |