Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens COMM domain containing 6 (COMMD6), transcript variant 2 (NM_203495). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q7Z4G1 |
| Entry Name | COMD6_HUMAN |
| Gene Names | COMMD6 MSTP076 |
| Alternative Gene Names | |
| Alternative Protein Names | COMM domain-containing protein 6 |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 85 |
| Molecular Weight(Da) | 9638 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETV |
Background
| Function | FUNCTION: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Down-regulates activation of NF-kappa-B. Inhibits TNF-induced NFKB1 activation. {ECO:0000269|PubMed:15799966, ECO:0000269|PubMed:16573520, ECO:0000305|PubMed:21778237}. |
| Pathway | |
| Protein Families | |
| Tissue Specificity | Ubiquitous. Expressed in brain, heart, skeletal muscle, lung, pancreas, liver, kidney, small intestine and placenta. {ECO:0000269|PubMed:15799966, ECO:0000269|PubMed:16573520}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |