Recombinant Human COMMD6 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens COMM domain containing 6 (COMMD6), transcript variant 2 (NM_203495).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q7Z4G1
Entry Name COMD6_HUMAN
Gene Names COMMD6 MSTP076
Alternative Gene Names
Alternative Protein Names COMM domain-containing protein 6
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 85
Molecular Weight(Da) 9638
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETV
Background
Function FUNCTION: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). Down-regulates activation of NF-kappa-B. Inhibits TNF-induced NFKB1 activation. {ECO:0000269|PubMed:15799966, ECO:0000269|PubMed:16573520, ECO:0000305|PubMed:21778237}.
Pathway
Protein Families
Tissue Specificity Ubiquitous. Expressed in brain, heart, skeletal muscle, lung, pancreas, liver, kidney, small intestine and placenta. {ECO:0000269|PubMed:15799966, ECO:0000269|PubMed:16573520}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8054537

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human COMMD6 protein
Copyright © 2026-present Echo Bio. All rights reserved.