Recombinant Human Collagen alpha-2 (VI) chain(COL6A2),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P12110
Gene Names COL6A2
Alternative Names CO6A2_HUMAN; COL6A2; Collagen alpha 2(VI) chain; Collagen alpha-2(VI) chain; collagen type VI alpha 2; Collagen VI alpha 2 polypeptide; human mRNA for collagen VI alpha 2 C terminal globular domain; PP3610
Expression Region Partial(941-1016aa )
Molecular Weight 13.4 kDa
Protein Sequence ELSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Collagen VI acts as a cell-binding protein.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity COL6A2
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$275.00
In stock
SKU
EB-PE2HU5877

Recombinant Human Collagen alpha-2 (VI) chain(COL6A2),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Collagen alpha-2 (VI) chain(COL6A2),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.