Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P12110 |
| Gene Names | COL6A2 |
| Alternative Names | |
| Expression Region | 254-400aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.74 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-166℃. |
| Protein Length | Partial of Isoform 2C2 |
| Molecular Weight | 35.2 kDa |
| Protein Sequence | IPGPSGPKGYRGQKGAKGNMGEPGEPGQKGRQGDPGIEGPIGFPGPKGVPGFKGEKGEFGADGRKGAPGLAGKNGTDGQKGKLGRIGPPGCKGDPGNRGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPGEIGAKGSKGYQGNSG |
Background
| Research Areas | Signal Transduction |
| Relevance | Collagen VI acts as a cell-binding protein. |
| Function | |
| Reference | "Further characterization of the three polypeptide chains of bovine and human short-chain collagen (intima collagen)." Jander R., Rauterberg J., Glanville R.W. Eur. J. Biochem. 133:39-46(1983) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |