Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P39060 |
| Gene Names | COL18A1 |
| Alternative Names | Alpha 1 collagen type 18 (XVIII)(COL18A1); Alpha 1 type XVIII collagen; Antiangiogenic agent; COIA1_HUMAN; COL15A1; Col18a1; Collagen alpha 1(XV) chain; Collagen alpha 1(XVIII) chain; Collagen alpha-1(XV) chain; Collagen type XV proteoglycan; Collagen type XVIII alpha 1; Collagen XV; alpha 1 polypeptide; Collagen; type XV; alpha 1; Endostatin; Endostatin XV; FLJ27325; FLJ34914; FLJ38566; KNO; KNO1; KS; MGC74745; Multi functional protein MFP; OTTHUMP00000021782; OTTHUMP00000115472; OTTHUMP00000115473 |
| Expression Region | Partial(1578-1754aa ) |
| Molecular Weight | 46.3 kDa |
| Protein Sequence | QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling. |
| Involvement in Disease | Knobloch syndrome 1 (KNO1) |
| Subcellular Location | Secreted, extracellular space, extracellular matrix, Secreted, extracellular space, extracellular matrix, basement membrane, SUBCELLULAR LOCATION: Non-collagenous domain 1: Secreted, extracellular space, extracellular matrix, basement membrane, Secreted, SUBCELLULAR LOCATION: Endostatin: Secreted, Secreted, extracellular space, extracellular matrix, basement membrane |
| Protein Families | Multiplexin collagen family |
| Tissue Specificity | COL18A1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |