Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P12107 |
| Gene Names | XI |
| Alternative Names | COBA1_HUMAN; COL11A1; COLL6; Collagen alpha 1; Collagen alpha-1(XI) chain; collagen XI alpha 1; collagen XI; alpha 1 polypeptide ; collagen; type XI; alpha 1; STL2; STL3; XI chain precursor |
| Expression Region | Partial(532-699aa ) |
| Molecular Weight | 42.8 kDa |
| Protein Sequence | GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May play an important role in fibrillogenesis by controlling lateral growth of collagen II fibrils. |
| Involvement in Disease | Stickler syndrome 2 (STL2); Marshall syndrome (MRSHS); Fibrochondrogenesis 1 (FBCG1) |
| Subcellular Location | Secreted, extracellular space, extracellular matrix |
| Protein Families | Fibrillar collagen family |
| Tissue Specificity | XI |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |