Recombinant Human CMRF35-like molecule 7(CD300LB),partial

Specification
Organism Homo sapiens (Human)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID A8K4G0
Gene Names CD300LB
Alternative Names CD300 antigen-like family member B CMRF35-A2 Immune receptor expressed on myeloid cells 3 Short name: IREM-3 Leukocyte mono-Ig-like receptor 5 Triggering receptor expressed on myeloid cells 5 Short name: TREM-5 CD_antigen: CD300b
Expression Region Extracellular Domain(18-151aa )
Molecular Weight 17.2 kDa
Protein Sequence IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.
Involvement in Disease
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families CD300 family
Tissue Specificity CD300LB
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$225.00
In stock
SKU
EB-PY9HU5044

Recombinant Human CMRF35-like molecule 7(CD300LB),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CMRF35-like molecule 7(CD300LB),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.