Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8TDQ1 |
| Gene Names | CD300LF |
| Alternative Names | CD300 antigen-like family member FImmune receptor expressed on myeloid cells 1 ;IREM-1Immunoglobulin superfamily member 13 ;IgSF13NK inhibitory receptor; CD300f |
| Expression Region | Extracellular Domain(20-156aa ) |
| Molecular Weight | 19.5 kDa |
| Protein Sequence | TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein |
| Protein Families | CD300 family |
| Tissue Specificity | CD300LF |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |