Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q11203 |
| Gene Names | ST3GAL3 |
| Alternative Names | Beta-galactoside alpha-2,3-sialyltransferase 3 ;Alpha 2,3-ST 3Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferaseN-acetyllactosaminide alpha-2,3-sialyltransferase;ST3Gal III ;ST3GalIIIST3NSialyltransferase 6 |
| Expression Region | Partial(29-375aa ) |
| Molecular Weight | 54.9 kDa |
| Protein Sequence | KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Catalyzes the formation of the NeuAc-alpha-2,3-Gal-beta-1,4-GlcNAc-, NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. The highest activity is toward Gal-beta-1,3-GlcNAc and the lowest toward Gal-beta-1,3-GalNAc . |
| Involvement in Disease | Mental retardation, autosomal recessive 12 (MRT12); Epileptic encephalopathy, early infantile, 15 (EIEE15) |
| Subcellular Location | Golgi apparatus, Golgi stack membrane, Single-pass type II membrane protein, Secreted |
| Protein Families | Glycosyltransferase 29 family |
| Tissue Specificity | ST3GAL3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |