Recombinant Human Claudin-6(CLDN6)-VLPs (Active)

Specification
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Protein Tag C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Purity Greater than 93% as determined by SDS-PAGE.
Endotoxin Level Less than 1.0 EU/ug as determined by LAL method.
Biological Activity Measured by its binding ability in a functional ELISA. Please contact us for the specific data.
Uniprot ID P56747
Gene Names CLDN6
Alternative Names (Skullin)
Expression Region 1-220aa
Product Form Lyophilized powder
Buffer Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.12
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-88℃.
Protein Length Full Length
Molecular Weight 25.1 kDa
Protein Sequence MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Background
Research Areas Cancer
Relevance "Claudin association with CD81 defines hepatitis C virus entry." Harris H.J., Davis C., Mullins J.G., Hu K., Goodall M., Farquhar M.J., Mee C.J., McCaffrey K., Young S., Drummer H., Balfe P., McKeating J.A. J. Biol. Chem. 285:21092-21102(2010)
Function
Reference
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$556.00
In stock
SKU
EB-N231009

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Claudin-6(CLDN6)-VLPs (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.