Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Protein Tag | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
| Purity | Greater than 93% as determined by SDS-PAGE. |
| Endotoxin Level | Less than 1.0 EU/ug as determined by LAL method. |
| Biological Activity | Measured by its binding ability in a functional ELISA. Please contact us for the specific data. |
| Uniprot ID | P56747 |
| Gene Names | CLDN6 |
| Alternative Names | (Skullin) |
| Expression Region | 1-220aa |
| Product Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.12 |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-88℃. |
| Protein Length | Full Length |
| Molecular Weight | 25.1 kDa |
| Protein Sequence | MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV |
Background
| Research Areas | Cancer |
| Relevance | "Claudin association with CD81 defines hepatitis C virus entry." Harris H.J., Davis C., Mullins J.G., Hu K., Goodall M., Farquhar M.J., Mee C.J., McCaffrey K., Young S., Drummer H., Balfe P., McKeating J.A. J. Biol. Chem. 285:21092-21102(2010) |
| Function | |
| Reference |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |