Specification
| Uniprot ID | P56747 |
| Gene Names | CLDN6 |
| Alternative Names | (Skullin) |
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
| Molecular Weight | 25.1 kDa |
| Expression Region | Full Length(1-220aa ) |
| Expression Region | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)(Full Length ) |
| Purity | The purity information is not available for VLPs proteins. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Biological Activity | Measured by its binding ability in a functional ELISA, the EC50 is 1.501-2.035 ng/mL |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
| Storage | Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
| Protein Sequence | MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV |
Background
| Research Areas | Cancer |
| Relevance | "Claudin association with CD81 defines hepatitis C virus entry." Harris H.J., Davis C., Mullins J.G., Hu K., Goodall M., Farquhar M.J., Mee C.J., McCaffrey K., Young S., Drummer H., Balfe P., McKeating J.A. J. Biol. Chem. 285:21092-21102(2010) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |