Specification
Gene Names | CLDN6 |
Alternative Names | UNQ757; PRO1488 |
Organism | Homo sapiens (Human) |
Expression Host | Mammalian cell |
Molecular Weight | 27.7 kDa |
Expression Region | Partial(2-220aa ) |
Expression Region | N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged(Partial ) |
Purity | Greater than 90% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Biological Activity | Measured by its binding ability in a functional ELISA. The EC50 is 0.6949-1.158 ng/mL. |
Form | Liquid |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | |
Storage | Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
Protein Sequence | ASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV |
Background
Research Areas | Cancer |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |