Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Protein Tag | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
| Purity | Testing in progress. |
| Endotoxin Level | Less than 1.0 EU/ug as determined by LAL method. |
| Biological Activity | Measured by its binding ability in a functional ELISA. Please contact us for the specific data. |
| Uniprot ID | O14493 |
| Gene Names | CLDN4 |
| Alternative Names | (Clostridium perfringens enterotoxin receptor)(CPE-R)(CPE-receptor)(Williams-Beuren syndrome chromosomal region 8 protein) |
| Expression Region | 1-209aa |
| Product Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.24 |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1100℃. |
| Protein Length | Full Length |
| Molecular Weight | 23.4 kDa |
| Protein Sequence | MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV |
Background
| Research Areas | Cancer |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |