Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-B2M-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O15551 |
| Gene Names | CLDN3 |
| Alternative Names | Clostridium perfringens enterotoxin receptor 2 |
| Expression Region | Partial(30-80aa ) |
| Molecular Weight | 19.7 kDa |
| Protein Sequence | RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. |
| Involvement in Disease | CLDN3 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. |
| Subcellular Location | Cell junction, tight junction, Cell membrane, Multi-pass membrane protein |
| Protein Families | Claudin family |
| Tissue Specificity | CLDN3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |