Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-B2M-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | O15551 |
Gene Names | CLDN3 |
Alternative Names | Clostridium perfringens enterotoxin receptor 2 |
Expression Region | Partial(30-80aa ) |
Molecular Weight | 19.7 kDa |
Protein Sequence | RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. |
Involvement in Disease | CLDN3 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. |
Subcellular Location | Cell junction, tight junction, Cell membrane, Multi-pass membrane protein |
Protein Families | Claudin family |
Tissue Specificity | CLDN3 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |