Recombinant Human Clathrin heavy chain 2(CLTCL1) ,partial

Specification
Organism Homo sapiens (Human)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P53675
Gene Names CLTCL1
Alternative Names Clathrin heavy chain on chromosome 22 ;CLH-22
Expression Region Partial(1423-1566aa )
Molecular Weight 18.8 kDa
Protein Sequence LLVLSPRLDHTWTVSFFSKAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLEKHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEEGKRECF
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma mbrane or to the trans-Golgi network .
Involvement in Disease
Subcellular Location Cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Membrane, coated pit, Peripheral membrane protein, Cytoplasmic side
Protein Families Clathrin heavy chain family
Tissue Specificity CLTCL1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$225.00
In stock
SKU
EB-PY4HU5719

Recombinant Human Clathrin heavy chain 2(CLTCL1) ,partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Clathrin heavy chain 2(CLTCL1) ,partial
Copyright © 2021-present Echo Biosystems. All rights reserved.