Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens CDGSH iron sulfur domain 1 (CISD1) (NM_018464). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9NZ45 |
| Entry Name | CISD1_HUMAN |
| Gene Names | CISD1 C10orf70 ZCD1 MDS029 |
| Alternative Gene Names | C10orf70 ZCD1 |
| Alternative Protein Names | CDGSH iron-sulfur domain-containing protein 1 (MitoNEET) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 108 |
| Molecular Weight(Da) | 12199 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET |
Background
| Function | FUNCTION: Plays a key role in regulating maximal capacity for electron transport and oxidative phosphorylation (By similarity). May be involved in Fe-S cluster shuttling and/or in redox reactions. {ECO:0000250, ECO:0000269|PubMed:17584744, ECO:0000269|PubMed:17766440}. |
| Pathway | |
| Protein Families | CISD protein family |
| Tissue Specificity | Expression is reduced in cells derived from cystic fibrosis patients. {ECO:0000269|PubMed:18047834}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |