Recombinant Human CISD1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens CDGSH iron sulfur domain 1 (CISD1) (NM_018464).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9NZ45
Entry Name CISD1_HUMAN
Gene Names CISD1 C10orf70 ZCD1 MDS029
Alternative Gene Names C10orf70 ZCD1
Alternative Protein Names CDGSH iron-sulfur domain-containing protein 1 (MitoNEET)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 108
Molecular Weight(Da) 12199
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET
Background
Function FUNCTION: Plays a key role in regulating maximal capacity for electron transport and oxidative phosphorylation (By similarity). May be involved in Fe-S cluster shuttling and/or in redox reactions. {ECO:0000250, ECO:0000269|PubMed:17584744, ECO:0000269|PubMed:17766440}.
Pathway
Protein Families CISD protein family
Tissue Specificity Expression is reduced in cells derived from cystic fibrosis patients. {ECO:0000269|PubMed:18047834}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8438455

Recombinant Human CISD1 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CISD1 protein
Copyright © 2026-present Echo Bio. All rights reserved.