Recombinant Human Chromogranin-A(CHGA),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P10645
Gene Names CHGA
Alternative Names Pituitary secretory protein I ;SP-I
Expression Region Partial(224-457aa )
Molecular Weight 53.4 kDa
Protein Sequence QAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Pancreastatin: Strongly inhibits glucose induced insulin release from the pancreas.Catestatin: Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic antagonist . Displays antibacterial activity against Gram-positive bacteria S.aureus and M.luteus, and Gram-negative bacteria E.coli and P.aeruginosa . Can induce mast cell migration, degranulation and production of cytokines and chokines . Acts as a potent scavenger of free radicals in vitro . May play a role in the regulation of cardiac function and blood pressure .
Involvement in Disease
Subcellular Location Cytoplasmic vesicle, secretory vesicle lumen, Cytoplasmic vesicle, secretory vesicle membrane, Secreted, Note=Associated with the secretory granule membrane through direct interaction to SCG3 that in turn binds to cholesterol-enriched lipid rafts in intragranular conditions, SUBCELLULAR LOCATION: Serpinin: Secreted, Cytoplasmic vesicle, secretory vesicle
Protein Families Chromogranin/secretogranin protein family
Tissue Specificity CHGA
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PEHU153566

Recombinant Human Chromogranin-A(CHGA),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Chromogranin-A(CHGA),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.