Recombinant Human Chromodomain-helicase-DNA-binding protein 4(CHD4) ,partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged and C-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q14839
Gene Names CHD4
Alternative Names ATP-dependent helicase CHD4Mi-2 autoantigen 218KDA protein;Mi2-beta
Expression Region Partial(1-239aa )
Molecular Weight 31.8 kDa
Protein Sequence MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVES
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Component of the histone deacetylase NuRD complex which participates in the rodeling of chromatin by deacetylating histones.
Involvement in Disease Sifrim-Hitz-Weiss syndrome (SIHIWES)
Subcellular Location Nucleus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome
Protein Families SNF2/RAD54 helicase family
Tissue Specificity CHD4
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PR74h11099

Recombinant Human Chromodomain-helicase-DNA-binding protein 4(CHD4) ,partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Chromodomain-helicase-DNA-binding protein 4(CHD4) ,partial
Copyright © 2021-present Echo Biosystems. All rights reserved.