Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged and C-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q14839 |
| Gene Names | CHD4 |
| Alternative Names | ATP-dependent helicase CHD4Mi-2 autoantigen 218KDA protein;Mi2-beta |
| Expression Region | Partial(1-239aa ) |
| Molecular Weight | 31.8 kDa |
| Protein Sequence | MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVES |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Component of the histone deacetylase NuRD complex which participates in the rodeling of chromatin by deacetylating histones. |
| Involvement in Disease | Sifrim-Hitz-Weiss syndrome (SIHIWES) |
| Subcellular Location | Nucleus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome |
| Protein Families | SNF2/RAD54 helicase family |
| Tissue Specificity | CHD4 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |