Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens CDC42 small effector 2 (CDC42SE2), transcript variant 1 (NM_020240). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9NRR3 |
| Entry Name | C42S2_HUMAN |
| Gene Names | CDC42SE2 SPEC2 |
| Alternative Gene Names | SPEC2 |
| Alternative Protein Names | CDC42 small effector protein 2 (Small effector of CDC42 protein 2) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 84 |
| Molecular Weight(Da) | 9223 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG |
Background
| Function | FUNCTION: Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages. {ECO:0000269|PubMed:10816584, ECO:0000269|PubMed:15840583}. |
| Pathway | |
| Protein Families | CDC42SE/SPEC family |
| Tissue Specificity | Widely expressed. Expressed at higher level in T-lymphocytes. Highly expressed in CCRF-CEM T-lymphocytes, Jurkat T-lymphocytes, and Raji B-lymphocytes compared (at protein level). {ECO:0000269|PubMed:15840583}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |