Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P08962 |
| Gene Names | CD63 |
| Alternative Names | Granulophysin Lysosomal-associated membrane protein 3 Short name: LAMP-3 Melanoma-associated antigen ME491 OMA81H Ocular melanoma-associated antigen Tetraspanin-30 Short name: Tspan-30 CD_antigen: CD63 MLA1, TSPAN30 |
| Expression Region | Partial(103-203aa ) |
| Molecular Weight | 15.5 kDa |
| Protein Sequence | AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Functions as cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Multi-pass membrane protein, Lysosome membrane, Multi-pass membrane protein, Late endosome membrane, Multi-pass membrane protein, Endosome, multivesicular body, Melanosome, Secreted, exosome, Cell surface |
| Protein Families | Tetraspanin (TM4SF) family |
| Tissue Specificity | CD63 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |