Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P13987 |
| Gene Names | CD59 |
| Alternative Names | 1F5 antigen20KDA homologous restriction factor ;HRF-20 ;HRF20MAC-inhibitory protein ;MAC-IPMEM43 antigen;Membrane attack complex inhibition factor ;MACIF;Membrane inhibitor of reactive lysis ;MIRLProtectin; CD59 |
| Expression Region | Full Length of Mature Protein(26-102aa ) |
| Molecular Weight | 36 kDa |
| Protein Sequence | LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Potent inhibitor of the complent mbrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complents of the assbling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.The soluble form from urine retains its specific complent binding activity, but exhibits greatly reduced ability to inhibit MAC assbly on cell mbranes. |
| Involvement in Disease | Hemolytic anemia, CD59-mediated, with or without polyneuropathy (HACD59) |
| Subcellular Location | Cell membrane, Lipid-anchor, GPI-anchor, Secreted |
| Protein Families | |
| Tissue Specificity | CD59 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
