Recombinant Human CD59 glycoprotein(CD59)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P13987
Gene Names CD59
Alternative Names 1F5 antigen20KDA homologous restriction factor ;HRF-20 ;HRF20MAC-inhibitory protein ;MAC-IPMEM43 antigen;Membrane attack complex inhibition factor ;MACIF;Membrane inhibitor of reactive lysis ;MIRLProtectin; CD59
Expression Region Full Length of Mature Protein(26-102aa )
Molecular Weight 36 kDa
Protein Sequence LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Potent inhibitor of the complent mbrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complents of the assbling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.The soluble form from urine retains its specific complent binding activity, but exhibits greatly reduced ability to inhibit MAC assbly on cell mbranes.
Involvement in Disease Hemolytic anemia, CD59-mediated, with or without polyneuropathy (HACD59)
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor, Secreted
Protein Families
Tissue Specificity CD59
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE7HU5072

Recombinant Human CD59 glycoprotein(CD59)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CD59 glycoprotein(CD59)
Copyright © 2021-present Echo Biosystems. All rights reserved.