Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal hFc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P09326 |
| Gene Names | CD48 |
| Alternative Names | B-lymphocyte activation marker BLAST-1 BCM1 surface antigen Leukocyte antigen MEM-102 SLAM family member 2 Short name: SLAMF2 Signaling lymphocytic activation molecule 2 TCT.1 CD_antigen: CD48 BCM1, BLAST1 |
| Expression Region | Full Length of Mature Protein(27-220aa ) |
| Molecular Weight | 48.3 kDa |
| Protein Sequence | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation. |
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Lipid-anchor, GPI-anchor |
| Protein Families | |
| Tissue Specificity | CD48 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |