Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9NPF0 |
| Gene Names | CD320 |
| Alternative Names | 8D6 antigenFDC-signaling molecule 8D6 ;FDC-SM-8D6Transcobalamin receptor ;TCblR;; CD320 |
| Expression Region | Partial(36-231aa ) |
| Molecular Weight | 47.1 kDa |
| Protein Sequence | SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Germinal center-B (GC-B) cells differentiate into mory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10. Receptor for the cellular uptake of transcobalamin bound cobalamin. |
| Involvement in Disease | Methylmalonic aciduria, transient, due to transcobalamin receptor defect (MMATC) |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein |
| Protein Families | |
| Tissue Specificity | CD320 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |