Recombinant Human CD276 antigen(CD276),partial (Active)

Specification
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Tag Info C-terminal hFc-Myc-tagged
Purity Greater than 93% as determined by SDS-PAGE.
Uniprot ID Q5ZPR3
Uniprot Entry Name
Gene Names CD276
Alternative Names 4Ig-B7-H3 (B7 homolog 3) (B7-H3) (Costimulatory molecule) (CD276)
Expression Region Partial (29-245aa)
Molecular Weight 53.4 kDa
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Sequence LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4)
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Background
Relevance May participate in the regulation of T-cell-mediated immune response. May play a protective role in tumor cells by inhibiting natural-killer mediated cell lysis as well as a role of marker for detection of neuroblastoma cells. May be involved in the development of acute and chronic transplant rejection and in the regulation of lymphocytic activity at mucosal surfaces. Could also play a key role in providing the placenta and fetus with a suitable immunological environment throughout pregnancy. Both isoform 1 and isoform 2 appear to be redundant in their ability to modulate CD4 T-cell responses. Isoform 2 is shown to enhance the induction of cytotoxic T-cells and selectively stimulates interferon gamma production in the presence of T-cell receptor signaling.
Function
Involvement in disease
Subcellular Location
Protein Families
Tissue Specificity
Pathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$133.00
In stock
SKU
EB-CMPHU733703

Recombinant Human CD276 antigen(CD276),partial (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CD276 antigen(CD276),partial (Active)
Copyright © 2026-present Echo Bio. All rights reserved.