Recombinant Human CD160 antigen(CD160) (Active)

Specification
Organism Homo sapiens (Human)
Expression Host Mammalian cell
Tag Info C-terminal 6xHis-tagged
Purity Greater than 90% as determined by SDS-PAGE.
Uniprot ID O95971
Uniprot Entry Name
Gene Names CD160
Alternative Names CD160 Antigen; Natural Killer Cell Receptor BY55; CD160; BY55
Expression Region Full Length of Mature Protein (27-159aa)
Molecular Weight 15.8 kDa
Endotoxin Less than 1.0 EU/µg as determined by LAL method.
Sequence INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4)
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Background
Relevance CD160 antigen is a Lipid-anchor that exists as a disulfide-linked homomultimer. CD160 contains one Ig-like V-type domain. The human CD160 precursor is a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain. It is weakly homologous to KIR2DL4. CD160 is expressed in the spleen, peripheral blood, and small intestine. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. CD160 is a receptor showing broad specificity for both classical and non-classical MHC class I molecules.
Function Receptor showing broad specificity for both classical and non-classical MHC class I molecules.
Involvement in disease
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Protein Families
Tissue Specificity Expressed in spleen, peripheral blood, and small intestine. Expression is restricted to functional NK and T cytotoxic lymphocytes.
Pathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$86.00
In stock
SKU
EB-CAPHU5346

Recombinant Human CD160 antigen(CD160) (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CD160 antigen(CD160) (Active)
Copyright © 2026-present Echo Bio. All rights reserved.