Recombinant Human CCN5 protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens WNT1 inducible signaling pathway protein 2 (CCN5), transcript variant 3 (NM_003881).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID O76076
Entry Name CCN5_HUMAN
Gene Names CCN5 CT58 CTGFL WISP2 UNQ228/PRO261
Alternative Gene Names CT58 CTGFL WISP2
Alternative Protein Names CCN family member 5 (Connective tissue growth factor-like protein) (CTGF-L) (Connective tissue growth factor-related protein 58) (WNT1-inducible-signaling pathway protein 2) (WISP-2)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 250
Molecular Weight(Da) 26825
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Background
Function FUNCTION: May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.
Pathway
Protein Families CCN family
Tissue Specificity Expressed in primary osteoblasts, fibroblasts, ovary, testes, and heart.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8541755

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CCN5 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.