Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens C-C motif chemokine ligand 4 like 1 (CCL4L1), transcript variant CCL4L (NM_207007). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q8NHW4 |
| Entry Name | CC4L_HUMAN |
| Gene Names | CCL4L1 CCL4L LAG1 SCYA4L1; CCL4L2 CCL4L SCYA4L2 |
| Alternative Gene Names | CCL4L LAG1 SCYA4L1; CCL4L SCYA4L2 |
| Alternative Protein Names | C-C motif chemokine 4-like (Lymphocyte activation gene 1 protein) (LAG-1) (Macrophage inflammatory protein 1-beta) (MIP-1-beta) (Monocyte adherence-induced protein 5-alpha) (Small-inducible cytokine A4-like) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 92 |
| Molecular Weight(Da) | 10166 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN |
Background
| Function | FUNCTION: Chemokine that induces chemotaxis of cells expressing CCR5 or CCR1. Inhibits HIV replication in peripheral blood monocytes that express CCR5. {ECO:0000269|PubMed:15240137}. |
| Pathway | |
| Protein Families | Intercrine beta (chemokine CC) family |
| Tissue Specificity | Detected in B-cells. {ECO:0000269|PubMed:14673550}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |