Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens C-C motif chemokine ligand 24 (CCL24) (NM_002991). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | O00175 |
| Entry Name | CCL24_HUMAN |
| Gene Names | CCL24 MPIF2 SCYA24 |
| Alternative Gene Names | MPIF2 SCYA24 |
| Alternative Protein Names | C-C motif chemokine 24 (CK-beta-6) (Eosinophil chemotactic protein 2) (Eotaxin-2) (Myeloid progenitor inhibitory factor 2) (MPIF-2) (Small-inducible cytokine A24) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 119 |
| Molecular Weight(Da) | 13134 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC |
Background
| Function | FUNCTION: Chemotactic for resting T-lymphocytes, and eosinophils (PubMed:9104803, PubMed:9365122). Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes (PubMed:9104803, PubMed:9365122). Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line (PubMed:9104803, PubMed:9365122). Binds to CCR3 (PubMed:9104803, PubMed:9365122). {ECO:0000269|PubMed:9104803, ECO:0000269|PubMed:9365122}. |
| Pathway | |
| Protein Families | Intercrine beta (chemokine CC) family |
| Tissue Specificity | Activated monocytes and activated T lymphocytes. {ECO:0000269|PubMed:9104803}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |