Recombinant Human CCL1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens C-C motif chemokine ligand 1 (CCL1) (NM_002981).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P22362
Entry Name CCL1_HUMAN
Gene Names CCL1 SCYA1
Alternative Gene Names SCYA1
Alternative Protein Names C-C motif chemokine 1 (Small-inducible cytokine A1) (T lymphocyte-secreted protein I-309)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 96
Molecular Weight(Da) 10992
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Background
Function FUNCTION: Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8. {ECO:0000269|PubMed:1557400}.
Pathway
Protein Families Intercrine beta (chemokine CC) family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8497575

Recombinant Human CCL1 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CCL1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.