Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P53567 |
| Gene Names | CEBPG |
| Alternative Names | C/EBP gamma; CCAAT/enhancer binding protein (C/EBP) gamma; CCAAT/enhancer binding protein gamma; CCAAT/enhancer-binding protein gamma; CEBPG; CEBPG_HUMAN; GPE1BP; IG/EBP 1; IG/EBP1 |
| Expression Region | Partial(1-148aa ) |
| Molecular Weight | 20.2 kDa |
| Protein Sequence | MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Transcription factor that binds to the enhancer elent PRE-I (positive regulatory elent-I) of the IL-4 gene. Might change the DNA-binding specificity of other transcription factors and recruit th to unusual DNA sites. |
| Involvement in Disease | |
| Subcellular Location | Nucleus |
| Protein Families | BZIP family, C/EBP subfamily |
| Tissue Specificity | CEBPG |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |