Recombinant Human CBR4 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens carbonyl reductase 4 (CBR4) (NM_032783).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8N4T8
Entry Name CBR4_HUMAN
Gene Names CBR4 SDR45C1
Alternative Gene Names SDR45C1
Alternative Protein Names 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) (3-ketoacyl-[acyl-carrier-protein] reductase beta subunit) (KAR beta subunit) (Carbonyl reductase family member 4) (CBR4) (Quinone reductase CBR4) (EC 1.6.5.10) (Short chain dehydrogenase/reductase family 45C member 1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 237
Molecular Weight(Da) 25301
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
Background
Function FUNCTION: Component of the heterotetramer complex KAR (3-ketoacyl-[acyl carrier protein] reductase or 3-ketoacyl-[ACP] reductase) that forms part of the mitochondrial fatty acid synthase (mtFAS). Beta-subunit of the KAR heterotetramer complex, responsible for the 3-ketoacyl-ACP reductase activity of the mtFAS, reduces 3-oxoacyl-[ACP] to (3R)-hydroxyacyl-[ACP] in a NADPH-dependent manner with no chain length preference, thereby participating in mitochondrial fatty acid biosynthesis (PubMed:25203508). The homotetramer has NADPH-dependent quinone reductase activity (in vitro), hence could play a role in protection against cytotoxicity of exogenous quinones (PubMed:19000905). As a heterotetramer, it can also reduce 9,10-phenanthrenequinone, 1,4-benzoquinone and various other o-quinones and p-quinones (in vitro) (PubMed:19000905, PubMed:19571038, PubMed:25203508). {ECO:0000269|PubMed:19000905, ECO:0000269|PubMed:19571038, ECO:0000269|PubMed:25203508}.
Pathway Lipid metabolism; fatty acid biosynthesis.
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity Detected in liver and kidney (at protein level) (PubMed:19000905). Displays the highest expression in neuronal and muscle tissues (PubMed:25203508). {ECO:0000269|PubMed:19000905, ECO:0000303|PubMed:25203508}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8311385

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CBR4 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.