Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9UBX1 |
| Gene Names | CTSF |
| Alternative Names | AI481912; CATF_HUMAN; Cathepsin F; CathepsinF; CATSF; CLN13; Ctsf; EC 3.4.22.41 |
| Expression Region | Partial(273-484aa ) |
| Molecular Weight | 27.4 kDa |
| Protein Sequence | PEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis. |
| Involvement in Disease | Ceroid lipofuscinosis, neuronal, 13 (CLN13) |
| Subcellular Location | Lysosome |
| Protein Families | Peptidase C1 family |
| Tissue Specificity | CTSF |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |