Recombinant Human Cathepsin D(CTSD),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P07339
Gene Names CTSD
Alternative Names CatD; CATD_HUMAN; Cathepsin D; Cathepsin D heavy chain; CD; Ceroid lipofuscinosis neuronal 10; CLN10; CPSD; ctsd; Epididymis secretory sperm binding protein Li 130P; HEL S 130P; Lysosomal aspartyl peptidase; Lysosomal aspartyl protease; MGC2311
Expression Region Partial(67-403aa )
Molecular Weight 63.8 kDa
Protein Sequence IPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNR
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Acid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease.
Involvement in Disease Ceroid lipofuscinosis, neuronal, 10 (CLN10)
Subcellular Location Lysosome, Melanosome, Secreted, extracellular space
Protein Families Peptidase A1 family
Tissue Specificity CTSD
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE1e0618835

Recombinant Human Cathepsin D(CTSD),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Cathepsin D(CTSD),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.