Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P21964 |
| Gene Names | COMT |
| Alternative Names | Catechol O methyltransferase; Catechol O-methyltransferase; COMT; COMT_HUMAN; EC 2.1.1.6 |
| Expression Region | Partial(52-271aa ) |
| Molecular Weight | 28.3 kDa |
| Protein Sequence | GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol. |
| Involvement in Disease | Schizophrenia (SCZD) |
| Subcellular Location | Isoform Soluble: Cytoplasm, SUBCELLULAR LOCATION: Isoform Membrane-bound: Cell membrane, Single-pass type II membrane protein, Extracellular side |
| Protein Families | Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family |
| Tissue Specificity | COMT |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |