Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P31944 |
| Gene Names | CASP14 |
| Alternative Names | Apoptosis related cysteine protease; CASP 14; CASP-14; CASP14; Caspase 14 apoptosis related cysteine protease; Caspase 14 precursor; Caspase-14 subunit p10; Caspase14; CASPE_HUMAN; MGC119078; MGC119079; MICE; Mini ICE |
| Expression Region | Full Length of Mature Protein(153-240aa ) |
| Molecular Weight | 37.2 kDa |
| Protein Sequence | KDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Non-apoptotic caspase involved in epidermal differentiation. Is the predominant caspase in epidermal stratum corneum . Ses to play a role in keratinocyte differentiation and is required for cornification. Regulates maturation of the epidermis by proteolytically processing filaggrin . In vitro has a preference for the substate [WY]-X-X-D motif and is active on the synthetic caspase substrate WEHD-ACF . Involved in processing of prosaposin in the epidermis . May be involved in retinal pigment epithelium cell barrier function . Involved in DNA degradation in differentiated keratinocytes probably by cleaving DFFA/ICAD leading to liberation of DFFB/CAD . |
| Involvement in Disease | Ichthyosis, congenital, autosomal recessive 12 (ARCI12) |
| Subcellular Location | Cytoplasm, Nucleus |
| Protein Families | Peptidase C14A family |
| Tissue Specificity | CASP14 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |