Recombinant Human CASP7 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens caspase 7 (CASP7), transcript variant d (NM_033338).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P55210
Entry Name CASP7_HUMAN
Gene Names CASP7 MCH3
Alternative Gene Names MCH3
Alternative Protein Names Caspase-7 (CASP-7) (EC 3.4.22.60) (Apoptotic protease Mch-3) (CMH-1) (ICE-like apoptotic protease 3) (ICE-LAP3) [Cleaved into: Caspase-7 subunit p20; Caspase-7 subunit p11]
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 303
Molecular Weight(Da) 34277
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Background
Function FUNCTION: Involved in the activation cascade of caspases responsible for apoptosis execution (PubMed:8521391, PubMed:8576161, PubMed:8567622, PubMed:9070923, PubMed:11701129). Cleaves and activates sterol regulatory element binding proteins (SREBPs) (PubMed:8521391, PubMed:8576161, PubMed:8567622, PubMed:9070923). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death (PubMed:8521391, PubMed:8576161, PubMed:8567622, PubMed:9070923). Cleaves phospholipid scramblase proteins XKR4, XKR8 and XKR9 (By similarity). {ECO:0000250|UniProtKB:P97864, ECO:0000269|PubMed:11701129, ECO:0000269|PubMed:8521391, ECO:0000269|PubMed:8567622, ECO:0000269|PubMed:8576161, ECO:0000269|PubMed:9070923}.; FUNCTION: [Isoform Beta]: Lacks enzymatic activity. {ECO:0000269|PubMed:8521391}.
Pathway
Protein Families Peptidase C14A family
Tissue Specificity Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8058815

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human CASP7 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.