Specification
Organism | Homo sapiens (Human) |
Expression Host | Mammalian cell |
Protein Tag | C-terminal?0xHis-tagged |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin Level | Less than 1.0 EU/ug as determined by LAL method. |
Biological Activity | Measured by its binding ability in a functional ELISA. Please contact us for the specific data. |
Uniprot ID | P06731 |
Gene Names | CEACAM5 |
Alternative Names | (Carcinoembryonic antigen)(CEA)(Meconium antigen 100)(CD antigen CD66e) |
Expression Region | 35-685aa(E398K) |
Product Form | Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.1391 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-1510℃. |
Protein Length | Partial |
Molecular Weight | 74.1 kDa |
Protein Sequence | KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA |
Background
Research Areas | Cancer |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |