Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4(CEACAM4),partial

Specification
Organism Homo sapiens (Human)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O75871
Gene Names CEACAM4
Alternative Names Carcinoembryonic antigen CGM7Non-specific cross-reacting antigen W236
Expression Region Partial(36-155aa )
Molecular Weight 14.7 kDa
Protein Sequence FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
Involvement in Disease
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Immunoglobulin superfamily, CEA family
Tissue Specificity CEACAM4
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$225.00
In stock
SKU
EB-PY4HU5289

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4(CEACAM4),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4(CEACAM4),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.