Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | C-terminal 6xHis-tagged |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | Q9Y2D0 |
| Uniprot Entry Name | |
| Gene Names | CA5B |
| Alternative Names | Carbonic Anhydrase 5B Mitochondrial; Carbonate Dehydratase VB; Carbonic Anhydrase VB; CA-VB; CA5B |
| Expression Region | Full Length of Mature Protein (34-317aa) |
| Molecular Weight | 33.77 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP |
| Product Form | Liquid (0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.0) |
| Reconstitution |
Background
| Relevance | Carbonic Anhydrase 5B (CA5B) is a member of alpha-carbonic anhydrase family (CAs) that catalyze the reversible hydration of carbon dioxide. CAs is associated with many biological processes, including calcification, respiration, bone resorption, acid-base balance and the formation of aqueous humor. CA5B is highly expressed in heart, pancreas, kidney, placenta, lung, and skeletal muscle, but it is restricted to the liver. CA5B is localized in the mitochondria and shows the highest sequence similarity to the other mitochondrial CA, CA-VA. CA5B is inhibited by coumarins, sulfonamide derivatives such as acetazolamide (AZA), saccharin, and Foscarnet. |
| Function | Reversible hydration of carbon dioxide. |
| Involvement in disease | |
| Subcellular Location | Mitochondrion |
| Protein Families | Alpha-carbonic anhydrase family |
| Tissue Specificity | Strongest expression in heart, pancreas, kidney, placenta, lung, and skeletal muscle. Not expressed in liver. |
| Pathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |