Specification
| Uniprot ID | P21554 |
| Gene Names | CNR1 |
| Alternative Names | (CB-R)(CB1)(CANN6) |
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Tag Info | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
| Molecular Weight | 54.6 kDa |
| Expression Region | Full Length(1-472aa ) |
| Expression Region | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)(Full Length ) |
| Purity | The purity information is not available for VLPs proteins. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Biological Activity | Measured by its binding ability in a functional ELISA, the EC50 is 41.72-63.54 ng/mL. |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
| Storage | Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
| Protein Sequence | MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL |
Background
| Research Areas | Cardiovascular |
| Relevance |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
