Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens calcium/calmodulin dependent protein kinase II inhibitor 2 (CAMK2N2) (NM_033259). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q96S95 |
| Entry Name | CK2N2_HUMAN |
| Gene Names | CAMK2N2 |
| Alternative Gene Names | |
| Alternative Protein Names | Calcium/calmodulin-dependent protein kinase II inhibitor 2 (CaM-KII inhibitory protein) (CaM-KIIN) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 79 |
| Molecular Weight(Da) | 8658 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPSGV |
Background
| Function | FUNCTION: Potent and specific cellular inhibitor of CaM-kinase II (CAMK2). Traps Ca(2+)/calmodulin on CAMK2. May play an important role in the regulation of cell growth when overexpressed in colon adenocarcinoma LoVo cells. Traps Ca(2+)/calmodulin on CAMK2. {ECO:0000269|PubMed:11444830}. |
| Pathway | |
| Protein Families | CAMK2N family |
| Tissue Specificity | Expressed in cell lines including hemopoietic cell lines and some tumor cell lines. Highly Expressed in stimulated dendritic cell (DC) and weakly expressed in unstimulated mature and immature DC. Highly expressed in kidney, liver, in cell lines HeLaS3, lymphoblastic leukemia MOLT-4, and Burkitt's lymphoma Raji. Moderately expressed in heart, skeletal muscle, placenta, and chronic myelogenous leukemia K-562 cells. Weakly expressed in small intestine, colorectal adenocarcinoma SW480, and lung carcinoma A-549 cells. {ECO:0000269|PubMed:11444830}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |