Recombinant Human C-X-C motif chemokine 5(CXCL5),partial (Active)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info Tag-Free
Purity Greater than 95% as determined by SDS-PAGE.
Uniprot ID P42830
Uniprot Entry Name
Gene Names CXCL5
Alternative Names C-X-C Motif Chemokine 5; ENA-78 (1-78); Epithelial-Derived Neutrophil-Activating Protein 78; Neutrophil-Activating Peptide ENA-78; Small-Inducible Cytokine B5; ENA-78 (8-78); ENA-78 (9-78); CXCL5; ENA78; SCYB5
Expression Region Partial (44-114aa)
Molecular Weight 7.95 kDa
Endotoxin Less than 1.0 EU/µg as determined by LAL method.
Sequence LRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Product Form Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, pH 6.0)
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance C-X-C Motif Chemokine 5 (CXCL5) is a member of the Intercrine Alpha (Chemokine CXC) family. CXCL5 can be cleaved into the following two chains, ENA-78 (8-78) and ENA-78 (9-78). In vitro, ENA-78(8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. CXCL5 is a secreted protein and exercises the functions primarily through interactions with CXCR2. The upregulation of CXCL5 contributes to increased vascularization, tumor grown, and metastasis in many cancers.
Function Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.
Involvement in disease
Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Tissue Specificity
Pathway Chemokinesignalingpathway
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$165.00
In stock
SKU
EB-CAPHU3686

Recombinant Human C-X-C motif chemokine 5(CXCL5),partial (Active)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human C-X-C motif chemokine 5(CXCL5),partial (Active)
Copyright © 2021-present Echo Biosystems. All rights reserved.