Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Uniprot ID | P19876 |
| Uniprot Entry Name | |
| Gene Names | CXCL3 |
| Alternative Names | C-X-C Motif Chemokine 3; GRO-Gamma (1-73); Growth-Regulated Protein Gamma; GRO-Gamma; Macrophage Inflammatory Protein 2-Beta; MIP2-Beta; GRO-Gamma (5-73); CXCL3; GRO3; GROG; SCYB3 |
| Expression Region | Full Length of Mature Protein (35-107aa) |
| Molecular Weight | 10.1 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4) |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | C-X-C Motif Chemokine 3 (CXCL3) is a secreted protein that belongs to the intercrine alpha (chemokine CXC) family. CXCL3 controls the migration and adhesion of monocytes and mediates its effect on its target cell by interacting with a cell surface chemokine receptor called CXCR2. In addition, CXCL3 is thought to play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. |
| Function | Ligand for CXCR2 (By similarity). Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes. |
| Involvement in disease | |
| Subcellular Location | Secreted |
| Protein Families | Intercrine alpha (chemokine CxC) family |
| Tissue Specificity | |
| Pathway | Chemokinesignalingpathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |