Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O43927 |
| Gene Names | CXCL13 |
| Alternative Names | AngieB cell-attracting chemokine 1 ;BCA-1B lymphocyte chemoattractantCXC chemokine BLCSmall-inducible cytokine B13 |
| Expression Region | Partial(23-95aa ) |
| Molecular Weight | 12.8 kDa |
| Protein Sequence | VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRS |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Chotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Intercrine alpha (chemokine CxC) family |
| Tissue Specificity | CXCL13 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |