Recombinant Human C-X-C motif chemokine 10(CXCL10)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info C-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P02778
Gene Names CXCL10
Alternative Names 10 kDa interferon gamma-induced protein INP10, SCYB10
Expression Region Full Length of Mature Protein(22-98aa )
Molecular Weight 10.6 kDa
Protein Sequence VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Involvement in Disease
Subcellular Location Secreted
Protein Families Intercrine alpha (chemokine CxC) family
Tissue Specificity CXCL10
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PEUc762532

Recombinant Human C-X-C motif chemokine 10(CXCL10)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human C-X-C motif chemokine 10(CXCL10)
Copyright © 2021-present Echo Biosystems. All rights reserved.